Protein Info for ABZR87_RS22770 in Ralstonia sp. UNC404CL21Col

Annotation: urea ABC transporter permease subunit UrtC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 45 to 71 (27 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 243 to 269 (27 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details TIGR03408: urea ABC transporter, permease protein UrtC" amino acids 30 to 348 (319 residues), 445 bits, see alignment E=1e-137 PF02653: BPD_transp_2" amino acids 38 to 338 (301 residues), 115.3 bits, see alignment E=1.5e-37

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 82% identity to hse:Hsero_2633)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtC" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>ABZR87_RS22770 urea ABC transporter permease subunit UrtC (Ralstonia sp. UNC404CL21Col)
MNPTLHSWLERRRDWLGLAVLCAVIFVVMPLAFDVFRLNLIGKYLSYAFVAVGLVLCWGY
GGILSLGQGVFFGLGGYCMAMFLKLEASDPVSTKIQSTPGIPDFMDWNQLTALPLFWEPF
RHFGFAVVAVVLVPTLLALLIGIAMFKRRVGDVYFSIVTQAIAAILSILIIGQQGWTGGV
NGITDLKTLLGWDIRTDSAKLILYFVTAGLLVGCIVLGRFILRSKLGRLLMAMRDKEERV
RFSGYDVASFKVFVFCVAAAMSAIGGAMFTLQVGFMSPSFVGIVPSIEMVIYAAVGGRLS
LLGAVYGTLLVNFGKTYFSESFPQLWLFLMGGLFIAVVMYFPNGLAGLYDSHGRKWIARL
LQGRRAAAKPAPGATAQG