Protein Info for ABZR87_RS22740 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 25 to 42 (18 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 121 to 146 (26 residues), see Phobius details amino acids 160 to 184 (25 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 387 to 409 (23 residues), see Phobius details amino acids 421 to 443 (23 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 404 (371 residues), 135.5 bits, see alignment E=1.1e-43

Best Hits

KEGG orthology group: None (inferred from 84% identity to bug:BC1001_2099)

Predicted SEED Role

"major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>ABZR87_RS22740 MFS transporter (Ralstonia sp. UNC404CL21Col)
MRTQTLSTEAPDDVAPLRAAGNVGHPVYIVLLFFVCFAFSYLDRQVVSILVQPIKQSLAL
SDTQIGLLQGFSFTMCYATAGVFVARLVDRANRVKLIAACIAIWAISTTACGFATNFPEL
LVARAGTAIAEAALSPAALSIFSDIFAPRRVARASSVFMLGPYVGGGLALFGGGMLLSAA
AAGSGSAWLAAHDIAPWQAVFIAVGLPGLVLAALVALTVREPLRREVQAHAARAEDEVPS
LKDVLTELFVRNRFCLAYFAGYVALITLFYSHAAWFPTLLMRRFHLAPNVVGQMAAPAYM
IGGMLGVACAGMLATRVTDETALRRVLAFSACAVAILLPAAIAMPLVGESSVAVVLYGAC
AFAASIAMGLAPVPLQIAMPNRMRGRSLALLVFMTNAISGGVGPLSVGYLNERLGQTGTS
LGMALALVGGVSALASAVLYTIATRRVPPASIQ