Protein Info for ABZR87_RS22680 in Ralstonia sp. UNC404CL21Col

Annotation: NAD-dependent epimerase/dehydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF04321: RmlD_sub_bind" amino acids 14 to 170 (157 residues), 55.3 bits, see alignment E=1.7e-18 PF01370: Epimerase" amino acids 15 to 250 (236 residues), 108.3 bits, see alignment E=1.2e-34 PF16363: GDP_Man_Dehyd" amino acids 16 to 315 (300 residues), 70.4 bits, see alignment E=6.1e-23 PF01073: 3Beta_HSD" amino acids 16 to 136 (121 residues), 25.2 bits, see alignment E=2.5e-09 PF02719: Polysacc_synt_2" amino acids 54 to 133 (80 residues), 25.1 bits, see alignment E=2.8e-09 PF07993: NAD_binding_4" amino acids 76 to 219 (144 residues), 23.5 bits, see alignment E=8.7e-09

Best Hits

KEGG orthology group: None (inferred from 91% identity to rpf:Rpic12D_3769)

Predicted SEED Role

"L-threonine 3-dehydrogenase (EC 1.1.1.103)" in subsystem Glycine Biosynthesis or Threonine degradation (EC 1.1.1.103)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.103

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>ABZR87_RS22680 NAD-dependent epimerase/dehydratase family protein (Ralstonia sp. UNC404CL21Col)
MSTGTTAKVGTAPRILIIGANGQLGTELAVALAERHGNGNVVTSDMVPRGRHPQIRHETL
DVTDRGQLREIIERHGITQIYHLAAALSAAAEQSPTWGWALNMNGLLNVLEAARNHQLER
IFWPSSIAAFGPTTPADNTPQSTIMEPKTVYGISKLAGEGWCRWYFEHHGVDVRSLRYPG
LISYKTAPGGGTTDYAIDIFHSAVKGERYTCFLEHDEALPMMYMPDAVRATIELMEAPAE
RITERGSYNLAGVSFTPEQLAAEIRRHRPSFEVAYAPDFRQAIAASWPNSIDDSVARRDW
GWRPEYGVAEMTTDMLQNLAHLAAHPA