Protein Info for ABZR87_RS22470 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 250 (166 residues), 45 bits, see alignment E=5.3e-16

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 78% identity to vap:Vapar_0306)

Predicted SEED Role

"ABC-type spermidine/putrescine transport system, permease component II"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>ABZR87_RS22470 ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MQKNGPLALIFNALVITFMLAPLVIVCIVAFTPEETLTLPTSHFSLRWFDQVLHHPDFVQ
SFWNSLWLGLAAATLSTALAVPAAMAIVRYRAPGLQYLQGVFLSPLIIPHLVLGVALLRM
FSLVGGQGSFGWLIFAHALIVTPYTMRLVMAALVGFDHSVEHAAYSLGASSLTVFRRMTL
PMILPGITGGWLLAFINSFDELTMSIFVVSPATVTLPVRMYMYATESLDPMMAAVSALIV
FLTLALMLLLDKVYGLDRILIGKH