Protein Info for ABZR87_RS22360 in Ralstonia sp. UNC404CL21Col
Annotation: (2Fe-2S)-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 44% identical to NICA_PSEPK: Nicotinate dehydrogenase subunit A (nicA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
KEGG orthology group: K07302, isoquinoline 1-oxidoreductase, alpha subunit [EC: 1.3.99.16] (inferred from 98% identity to rpf:Rpic12D_3728)MetaCyc: 59% identical to 2-deoxy-D-ribose dehydrogenase alpha subunit (Pseudomonas simiae)
1.1.2.M2 [EC: 1.1.2.M2]
Predicted SEED Role
"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)
MetaCyc Pathways
- 2-deoxy-D-ribose degradation II (3/8 steps found)
Isozymes
Compare fitness of predicted isozymes for: 1.3.99.16
Use Curated BLAST to search for 1.1.2.M2 or 1.3.99.16
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (152 amino acids)
>ABZR87_RS22360 (2Fe-2S)-binding protein (Ralstonia sp. UNC404CL21Col) MVTLNINGKPVEVDADPSTPLLWALRDNLGLTGTKFGCGVASCGACTVHLNGQPTRSCVL PISAVAGQQITTSEHIADDKVGKAVLDAWVKHDVAQCGYCQSGQMMSAVGLLRTKKKPTD ADIDSAMAGNLCRCATYQRIRAAIHDAAKSLA