Protein Info for ABZR87_RS22300 in Ralstonia sp. UNC404CL21Col

Annotation: flagellar biosynthesis anti-sigma factor FlgM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 TIGR03824: flagellar biosynthesis anti-sigma factor FlgM" amino acids 1 to 94 (94 residues), 55.2 bits, see alignment E=4.9e-19 PF04316: FlgM" amino acids 51 to 90 (40 residues), 36.9 bits, see alignment E=1.7e-13

Best Hits

Swiss-Prot: 40% identical to FLGM_SALTY: Negative regulator of flagellin synthesis (flgM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02398, negative regulator of flagellin synthesis FlgM (inferred from 83% identity to rpf:Rpic12D_3716)

Predicted SEED Role

"Negative regulator of flagellin synthesis" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>ABZR87_RS22300 flagellar biosynthesis anti-sigma factor FlgM (Ralstonia sp. UNC404CL21Col)
MKINHIVNNTPAVAPTKDAASGSTRSTGSSPAATTASGPTRHTGDSPSLSVQQVSRQVGS
GDFDAARVEQIRSAIQNGTLKMDAGKIADAALSDAQSLLSTRSKKV