Protein Info for ABZR87_RS22295 in Ralstonia sp. UNC404CL21Col

Annotation: flagellar basal body P-ring formation chaperone FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 50 (50 residues), see Phobius details PF17656: ChapFlgA_N" amino acids 110 to 166 (57 residues), 29.4 bits, see alignment E=1.3e-10 TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 156 to 291 (136 residues), 127.4 bits, see alignment E=1.8e-41 PF13144: ChapFlgA" amino acids 169 to 290 (122 residues), 94.5 bits, see alignment E=7.8e-31 PF08666: SAF" amino acids 169 to 230 (62 residues), 43.5 bits, see alignment E=5.6e-15

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 86% identity to rpi:Rpic_4792)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>ABZR87_RS22295 flagellar basal body P-ring formation chaperone FlgA (Ralstonia sp. UNC404CL21Col)
MSTRFARSTHHPIRPVTAAMPLAGRQRKLLLILALGLLASLMHPILAHAQGMMRVGYPPA
AANAPMPAQAAQQPQATTIQGPNAIQMQIQQQLQSQLDILGGTNETGAPRASVEVGPIDP
RVANQPCDQIDLMLPAANRLRGRIQVGVRCRSPHAWAAWVPATIQITGTYYVASHPLPPG
KTLDMGDLEARTGDLSTLPASVVQQPADVVGRVLLTSVAANQPLRAESLRLPVAVQAGQT
VKIVAEGGGFQVSSDGRALNQAAVGQVAQVRTGNGNVVSGIAQSAGVVAIQF