Protein Info for ABZR87_RS22290 in Ralstonia sp. UNC404CL21Col

Annotation: flagellar basal body rod protein FlgB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR01396: flagellar basal-body rod protein FlgB" amino acids 6 to 149 (144 residues), 113.5 bits, see alignment E=4e-37 PF00460: Flg_bb_rod" amino acids 12 to 39 (28 residues), 31.4 bits, see alignment 7.6e-12

Best Hits

KEGG orthology group: K02387, flagellar basal-body rod protein FlgB (inferred from 94% identity to rpf:Rpic12D_3714)

Predicted SEED Role

"Flagellar basal-body rod protein FlgB" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>ABZR87_RS22290 flagellar basal body rod protein FlgB (Ralstonia sp. UNC404CL21Col)
MVDKLDQLFGFQEQALHLRSQRHQVLASNIANADTPNYKARDFDFQSALQKAVGQQGGNS
LPMTATAAGHLSVDGAPAGDVSLMQASLSQQTKALQGEMQYRTSQQPSIDGNTVDMDGER
MRFADNTVRYEADLSIVTQKIKSMLAAIQNS