Protein Info for ABZR87_RS22260 in Ralstonia sp. UNC404CL21Col

Annotation: flagellar basal body L-ring protein FlgH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02107: FlgH
  • amino acids 60 to 243 (184 residues), 186.8 bits, E=1.3e-59

Best Hits

Swiss-Prot: 93% identical to FLGH_RALSO: Flagellar L-ring protein (flgH) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02393, flagellar L-ring protein precursor FlgH (inferred from 96% identity to rpi:Rpic_4785)

Predicted SEED Role

"Flagellar L-ring protein FlgH" in subsystem Flagellar motility or Flagellum

Protein Sequence (244 amino acids)

>ABZR87_RS22260 flagellar basal body L-ring protein FlgH (Ralstonia sp. UNC404CL21Col)
MHTPPVYSLTHSGRAVRIVRLAVLGTAALLATACGMLPPPAPIVQGPTTARPPMPVMAPR
QNGAIYQEVASGSGGFRGMFEDRRAHMVGDTITIVITENTAASKQTSGSVNRTGSMTASV
PTFAGMNPGVLSLLGVSASDANKFDSKGANGAQNNFTATITVTVVEVLSNGNLVVSGEKQ
TAVGQGTESVKFSGVVNPTTVNNQNTVLSTQVADARMEYRGTGYVAESQQMGWLSRFFLT
VSPF