Protein Info for ABZR87_RS22245 in Ralstonia sp. UNC404CL21Col

Annotation: flagellar hook-associated protein FlgK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 TIGR02492: flagellar hook-associated protein FlgK" amino acids 4 to 355 (352 residues), 263.9 bits, see alignment E=1.9e-82 PF00460: Flg_bb_rod" amino acids 6 to 35 (30 residues), 29.5 bits, see alignment (E = 1.5e-10) PF22638: FlgK_D1" amino acids 95 to 327 (233 residues), 252.6 bits, see alignment E=9.6e-79 PF21158: flgK_1st_1" amino acids 338 to 412 (75 residues), 41.3 bits, see alignment E=3.1e-14 PF21159: FlgK_2nd" amino acids 435 to 534 (100 residues), 25.8 bits, see alignment E=3.1e-09 PF06429: Flg_bbr_C" amino acids 599 to 641 (43 residues), 45.2 bits, see alignment 1.3e-15

Best Hits

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 90% identity to rpf:Rpic12D_3705)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (644 amino acids)

>ABZR87_RS22245 flagellar hook-associated protein FlgK (Ralstonia sp. UNC404CL21Col)
MSSSLLNIGASGLRVADINLQVTGNNIANASTPGYSRQEAVQTENIPLYAGVGYLGQGAN
VTTVKRIYDQFLTAQVQSGQASTSAADQLNSLVSGLSKYMSDSNSGLTSSLTSFFNAADG
LASKPSDTTARQVFLNAAAGLQSRFNSIAGQLSSLNSQVNTQVQTQISSVNGTAQQIASL
NDQISKAEASTGQPANDLRDQRDQLVQTLNQSIKASVVQTGDGQFNIYVGNGQALVQGNQ
SYQLTAVPSQYDPTQLSVGYKSPGGTVNIDDSQLGGGALGGLMDFRNNTLIPAQNSLGRL
ATAVAADVNAQNKLGMDANGKMGTDLFSVANPSVAPSTNNTGTGSLTASITNANAGQGYD
YQVKYQGGAYTVSHYPDGSASVTVTSWPTTIDGVTLNLSGTMNSGDSFLVRPTANAAATM
QTLTTDYHDVAAASPVVLNQGSNNTGSASVSSLGVDSTYAGSPLTSPINLTYSSAVGGSL
SGFPGSVTVTVGGTSTTYTGGTAPYTQGATYAFNGVQMTLSGSPGNGDTFAISANTANST
DNRNASALAKLRNSNLLDGGTTSIGSAWNNLVTQVGVQANRASTNLTSQKALLASSTQQQ
QSVSGVNLDDEAMNLMKYQQAYQASAKVMQTANSLFDSLLSIAG