Protein Info for ABZR87_RS22235 in Ralstonia sp. UNC404CL21Col

Annotation: YoaK family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 64 to 88 (25 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details PF06912: DUF1275" amino acids 25 to 235 (211 residues), 135.2 bits, see alignment E=1.3e-43

Best Hits

KEGG orthology group: None (inferred from 92% identity to rpi:Rpic_4780)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>ABZR87_RS22235 YoaK family protein (Ralstonia sp. UNC404CL21Col)
MPIQYLRRLTSPERSEDANRRLGQSLAFVAGAANAGGFLAVKQYTSHMSGIVSAIADDLV
LGDVVLVLAGFASLLAFLCGAACTAVLVNWGRRRSTQSEFALPLMLEAALLLLFGLMGTT
LGQYRVVFVPATVALLCFLMGLQNAIITKISKAEIRTTHVTGLATDIGIEIGKALYWNHG
HHNLPAVVANRPKLRLLVSLLGMFFVGGVVGALGFRHLGYTATIPLASILMLLAVVPVVD
DLLARRR