Protein Info for ABZR87_RS22220 in Ralstonia sp. UNC404CL21Col

Annotation: flagellar biosynthetic protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 72 to 96 (25 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 177 to 204 (28 residues), see Phobius details amino acids 215 to 238 (24 residues), see Phobius details PF01311: Bac_export_1" amino acids 14 to 245 (232 residues), 197.7 bits, see alignment E=1.1e-62 TIGR01400: flagellar biosynthetic protein FliR" amino acids 14 to 250 (237 residues), 182.9 bits, see alignment E=3.9e-58

Best Hits

Swiss-Prot: 38% identical to FLIR_ECOLI: Flagellar biosynthetic protein FliR (fliR) from Escherichia coli (strain K12)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 91% identity to rpf:Rpic12D_3682)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>ABZR87_RS22220 flagellar biosynthetic protein FliR (Ralstonia sp. UNC404CL21Col)
MIQFTATQLNGWIAMYWWPLVRVLAFIAIAPPFANTEIPTSIKVAFGVVITVALAPMLAV
PAGVSVGSYEGLWITLVQVLIGLALGFCVQLVFSAVSGAGEVMSVQMGLGFASLLDPTQT
ESSMLLGRFLSLTAVTAFIAGDGHLVLLHALFDSFTALPVSAAPLGNPGWQTLAGGGTIV
FALALRIALPIIAIMMIVNLGFAVLSRTAQALNPFAVGIAATLVVGLMLVMVMMTSLAPV
VERSVMDALDLGGRAFSQFSTLPR