Protein Info for ABZR87_RS22110 in Ralstonia sp. UNC404CL21Col

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF01041: DegT_DnrJ_EryC1" amino acids 11 to 367 (357 residues), 411.6 bits, see alignment E=3.4e-127 PF00266: Aminotran_5" amino acids 29 to 163 (135 residues), 25.1 bits, see alignment E=8.6e-10

Best Hits

Swiss-Prot: 43% identical to GDPPS_CAUVC: GDP-perosamine synthase (per) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 99% identity to rpi:Rpic_4737)

Predicted SEED Role

"perosamine synthetase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>ABZR87_RS22110 DegT/DnrJ/EryC1/StrS family aminotransferase (Ralstonia sp. UNC404CL21Col)
MTQKILYSKPSITELEVEYATDAARNGWGDQCYAYINRFEKQFAEFVGTQYAIATSSCTG
AMHMGLAALGIGAGDEVILADTNWIATASPITYVGATPVFVDILPDTWCLDPALVEAAIT
PRTKAIIATHLYGNLCEMDRLLDIGKRHGLPVIEDAAEAVGSRWHGHATGSQGIFGTFSF
HGTKTMTTGEGGMFVTNDRALYDRVMTLNNHGRVPGGKQFWSDFIGFKYRISNVQAAIGC
AQLERIDALVARKREIFAEYQVHLGGVAGLALNPEAPGTLNSYWMPTVVFDEALGITRDG
LLAAFSRRGIDARVFFYPLSQTELFGTSEATARRNAPNSYAIAERAINLPSYHDMSSENI
ATVCNVVLDLVKAHQETLTCLAS