Protein Info for ABZR87_RS22100 in Ralstonia sp. UNC404CL21Col

Annotation: CDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR02622: CDP-glucose 4,6-dehydratase" amino acids 12 to 355 (344 residues), 491.6 bits, see alignment E=6.6e-152 PF04321: RmlD_sub_bind" amino acids 16 to 172 (157 residues), 34.9 bits, see alignment E=2.8e-12 PF01370: Epimerase" amino acids 17 to 251 (235 residues), 115.6 bits, see alignment E=7.5e-37 PF16363: GDP_Man_Dehyd" amino acids 19 to 329 (311 residues), 127.4 bits, see alignment E=2.8e-40 PF01073: 3Beta_HSD" amino acids 20 to 188 (169 residues), 29.4 bits, see alignment E=1.3e-10 PF02719: Polysacc_synt_2" amino acids 67 to 232 (166 residues), 55.9 bits, see alignment E=1.2e-18 PF07993: NAD_binding_4" amino acids 83 to 179 (97 residues), 28.2 bits, see alignment E=3.2e-10

Best Hits

Swiss-Prot: 49% identical to RFBG_SALTY: CDP-glucose 4,6-dehydratase (rfbG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01709, CDP-glucose 4,6-dehydratase [EC: 4.2.1.45] (inferred from 92% identity to rpi:Rpic_4735)

MetaCyc: 52% identical to CDP-D-glucose-4,6-dehydratase monomer (Yersinia pseudotuberculosis)
CDP-glucose 4,6-dehydratase. [EC: 4.2.1.45]

Predicted SEED Role

"Similar to CDP-glucose 4,6-dehydratase (EC 4.2.1.45)" (EC 4.2.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>ABZR87_RS22100 CDP-glucose 4,6-dehydratase (Ralstonia sp. UNC404CL21Col)
MEKVVTLDPRAWAGKRVFLTGHTGFKGSWLALWLRQLGADVTGYSLAPETHPNLFTLAEA
ESALAGHTLGDIRDADALRAAMTAARPDVVFHLAAQPLVRASYQDPAGTYATNVMGTVNV
LEAARACAGLSAIVVATTDKCYDNREWAWGYRETDALGGHDPYSASKACAELVAASYRRA
FFANGPLLATGRAGNVIGGGDWSEDRLIPDAERAMRAGTPLVIRSPHATRPWQHVLDCLH
GYLVLAQRLLAGDAACATAWNFGPDSAATRTVEQVLQGLQHHWPALIWQLDANAAAGRHE
AGMLHLDASRARQQLGWQTAWPFETALEQTAAWYRHLHENTADARTLCDQQIDRFTAAAS
AATRRSAA