Protein Info for ABZR87_RS22095 in Ralstonia sp. UNC404CL21Col

Annotation: glucose-1-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02623: glucose-1-phosphate cytidylyltransferase
  • amino acids 1 to 257 (257 residues), 456.5 bits, E=1.2e-141
• PF00483: NTP_transferase
  • amino acids 2 to 204 (203 residues), 73.3 bits, E=2.5e-24
• PF12804: NTP_transf_3
  • amino acids 4 to 56 (53 residues), 30.4 bits, E=4.3e-11

Best Hits

Swiss-Prot: 65% identical to RFBF_SALTI: Glucose-1-phosphate cytidylyltransferase (rfbF) from Salmonella typhi

KEGG orthology group: K00978, glucose-1-phosphate cytidylyltransferase [EC: 2.7.7.33] (inferred from 99% identity to rpi:Rpic_4734)

MetaCyc: 63% identical to alpha-D-glucose-1-phosphate cytidylyltransferase monomer (Yersinia pseudotuberculosis)
Glucose-1-phosphate cytidylyltransferase. [EC: 2.7.7.33]

Predicted SEED Role

"Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33)" in subsystem dTDP-rhamnose synthesis (EC 2.7.7.33)

MetaCyc Pathways

• CDP-4-dehydro-3,6-dideoxy-D-glucose biosynthesis (3/3 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• superpathway of CDP-glucose-derived O-antigen building blocks biosynthesis (3/8 steps found)
• streptomycin biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.33

Protein Sequence (257 amino acids)

>ABZR87_RS22095 glucose-1-phosphate cytidylyltransferase (Ralstonia sp. UNC404CL21Col)
MKTVILAGGLGTRISEESHLRPKPMIEIGGRPILWHIMKIYAAHGINDFIICLGYKGYVI
KEYFANYFLHMSDVTFDMSKNEVTVHERHAEPWRITLVDTGEQSQTGGRLKRVAAYLDPN
EPFCFTYGDGVSDIDITSKIAFHRAHGKMATVTAVQPPGRYGMLQRDGARVTGFTEKPPG
DGGSWINGGFFVLNPSVIEYIASEDTPWEGAPMARLAEMGELNTFEHHGFWQPMDTLRDK
NSLEALWQAGSAPWKKW