Protein Info for ABZR87_RS22085 in Ralstonia sp. UNC404CL21Col

Annotation: flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02049: FliE
  • amino acids 32 to 113 (82 residues), 97.6 bits, E=1.9e-32
• TIGR00205: flagellar hook-basal body complex protein FliE
  • amino acids 35 to 113 (79 residues), 79.7 bits, E=1e-26

Best Hits

Swiss-Prot: 83% identical to FLIE_RALSO: Flagellar hook-basal body complex protein FliE (fliE) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 87% identity to rpi:Rpic_4732)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Protein Sequence (113 amino acids)

>ABZR87_RS22085 flagellar hook-basal body complex protein FliE (Ralstonia sp. UNC404CL21Col)
MDITNANSVVSLMNSVLAPSTKVGGIGAGGAASGDDAKVSVDFGAVLKSSLDRVDASQQK
AESVSRSFEMGNNDVDLHDVMLSLQKANIDMQTAVQVRNKFVSAYQSIMSMSI