Protein Info for ABZR87_RS21915 in Ralstonia sp. UNC404CL21Col

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 20 to 50 (31 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 204 to 231 (28 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 263 to 286 (24 residues), see Phobius details amino acids 306 to 333 (28 residues), see Phobius details PF01594: AI-2E_transport" amino acids 23 to 336 (314 residues), 52.4 bits, see alignment E=2.5e-18

Best Hits

KEGG orthology group: None (inferred from 80% identity to rsl:RPSI07_mp0370)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>ABZR87_RS21915 AI-2E family transporter (Ralstonia sp. UNC404CL21Col)
MTMLPPELPPNAHTRPINAISYVLVAAMIGAVLWLHLLPAAIAGFLVYALARKLEARLRA
RHTVSKRARAIAVICVFVIAALILAALGIGIGRLVEHGHGLEGMLTRIADVLDNLRESLP
AAVVNYVPQSVTELRVQLVQMIKEHGHQVSTMGIDGLRASALMLVGLILGAMVAWSETPD
AEHHKPLAAALVNRLSRLTDAFEAVVFAQVKISALNTALAAIYLLGALPLFGQHVPYSKS
LILLTFVAGLIPVAGNLISNTAIVVMSVTASLELAVASLIFLVVVHKLEYFVNARIIGSR
IDARAWELILALIVMEALFGVGGVIAAPVLYAYMKRELTDAGLIG