Protein Info for ABZR87_RS21870 in Ralstonia sp. UNC404CL21Col

Annotation: copper homeostasis membrane protein CopD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 88 to 112 (25 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details PF05425: CopD" amino acids 195 to 301 (107 residues), 96.5 bits, see alignment E=5.7e-32

Best Hits

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 61% identity to rsl:RPSI07_mp0536)

Predicted SEED Role

"Copper resistance protein D" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>ABZR87_RS21870 copper homeostasis membrane protein CopD (Ralstonia sp. UNC404CL21Col)
MPEDWLAVTLRFALYLDLMVLFGVSLFSVYALGPTDPSSGIARLYGRMTNASALAGIVLS
IWDVVAMAESMSGATRYSELTSHIFDMILTGTAVGAAWLVRLAVLAAGVVAANAWRRNAR
RRQIGLAASGAIALATLAWAGHGAMDDGLRGVLHLAADVTHLLAAGMWVGALVAFVVLSS
ARRTGTPHTVQTLSRAASGFATIGTCIVAMLIATGVVNYVLVAGPTFDALFTTPYGRLLL
GKLVLFALMLALAAGNRYRLSPRLAAAIRTGDATGAVKTLHRSLQAETCLAVLILALVAW
LGLLSPVPA