Protein Info for ABZR87_RS21830 in Ralstonia sp. UNC404CL21Col

Annotation: SRPBCC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08327: AHSA1
  • amino acids 24 to 157 (134 residues), 108 bits, E=4e-35
  • amino acids 183 to 317 (135 residues), 68.2 bits, E=8.1e-23

Best Hits

KEGG orthology group: None (inferred from 87% identity to rpi:Rpic_4711)

Predicted SEED Role

"Probable glutathione S-transferase-related transmembrane protein (EC 2.5.1.18)" (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• glutathione-mediated detoxification II (2/9 steps found)
• gliotoxin biosynthesis (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (320 amino acids)

>ABZR87_RS21830 SRPBCC family protein (Ralstonia sp. UNC404CL21Col)
MTTTIDSPAGTTLRPLVISRTFPVSRDWVFKAWSTADHIKRWFCPTHFTVPDATVEFRVG
GKFDVCMRSPEGQDHWSRGHFLEIVPNARLVIDMNVVDGDNRPLMNAHTVVTFAEETGGG
TRMEVTQTHTPLAPIAEMMIKGASEGWKQTLDKLEREAASVPVADGIQRSVVHATFTVER
TYDAPRSRVFKALTDPAAKAKWFAGGNGYTLLVREMDATPGGREVVKGRWDSGVVSSFEA
LYHDVIPNERVVYSYVMHLDDRKISASLATLELREPKDGSGGTHLVMTEQGAFLDGYDDS
GSRERGTQFLLDMLGNSLKD