Protein Info for ABZR87_RS21730 in Ralstonia sp. UNC404CL21Col

Annotation: heavy metal sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 12 to 479 (468 residues), 472.9 bits, see alignment E=6.1e-146 PF00672: HAMP" amino acids 196 to 249 (54 residues), 25.8 bits, see alignment 2.1e-09 PF00512: HisKA" amino acids 254 to 318 (65 residues), 53.1 bits, see alignment E=5.4e-18 PF02518: HATPase_c" amino acids 363 to 479 (117 residues), 95 bits, see alignment E=8.1e-31

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 76% identity to rsl:RPSI07_mp0424)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (480 amino acids)

>ABZR87_RS21730 heavy metal sensor histidine kinase (Ralstonia sp. UNC404CL21Col)
MASLNGTLMRWPTSLAGRLVLAFVVVASVTLTAAGTYLYFALNAQLRATDDAMLIGKIAQ
LRHLASEVPSADDLVRTAHRYTDVVSGHDGLILRIATPEGRTLVEVNPEGEQVTMPPVVA
AAVPPSESSVQTWTSMTGMASRAAAAEAWLGQNNAKVIVLVAQDGDSRAALLTQYQRHIV
FAVMGGVAAVALLSLLLVRGTLRGLARIGSQAAAVVPSQLDTRLTLQGAPRELADLLASL
NAMLTRLQDGFARLSQFSADLAHDFRTPLANLVGQTEVTLAHPRTGEEYRSVLESNLEEY
ARLSHMIEDMLFLARADHARVALSIEPLDARHEVQVLVDYFEAVAADRDIAIDVRGDARL
HADATLLRRAINNLLDNALRHTPTGERIDVTIETAPQGIAIAVHNPGPGIAPTALPLLFE
RFYRGDPSRAQSGAQSGAQSSQSTGLGLAIVKTIMDLHGGSVQASSPPGGRTEFRLVFPV