Protein Info for ABZR87_RS21710 in Ralstonia sp. UNC404CL21Col

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF16576: HlyD_D23" amino acids 81 to 312 (232 residues), 142.3 bits, see alignment E=2e-45 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 92 to 374 (283 residues), 165.9 bits, see alignment E=5.6e-53 PF13533: Biotin_lipoyl_2" amino acids 101 to 144 (44 residues), 28.7 bits, see alignment 1.4e-10 PF13437: HlyD_3" amino acids 210 to 309 (100 residues), 74.3 bits, see alignment E=1.8e-24

Best Hits

KEGG orthology group: None (inferred from 88% identity to rso:RSp0492)

MetaCyc: 52% identical to cobalt-zinc-cadmium resistance protein (Pseudomonas putida KT2440)
RXN1G01-61; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>ABZR87_RS21710 efflux RND transporter periplasmic adaptor subunit (Ralstonia sp. UNC404CL21Col)
MTLPPQQRRAIALIVVLGALAAVGLWFGMGARQAPTADAEAAPAPAATEQAEAPHAETLA
MTADAIANAKIGVDTAGAADLRTQVVLPGEIRLNEDRTAHVVPRVAGVAEKVAVELGQPV
TRGQLLAVLSSPALSDQRSELQAAQQRLALAQETHAREKRLWEQGIAAEQDYQQARTSLQ
EARIAADNARQKLTAIGAAPAGSALNRFELRAPFDGVVVAKHLSQGEAVQAETAVFTVAD
LRTVWADFSVTAKDLEAVTTNAAATVRATATGTAVQGKVSYVGTLLGEQTRTAPARVTLD
NPKLAWRPGMFVNVSVESGRVQVPVAVRADAVQTVDEKPSVFVPVPAGFEVRPVKTGRTD
GTWTEILEGLPAGARYAATNSYVLKAEAGKSADHGH