Protein Info for ABZR87_RS21705 in Ralstonia sp. UNC404CL21Col

Annotation: CusA/CzcA family heavy metal efflux RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1056 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 347 to 363 (17 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details amino acids 452 to 471 (20 residues), see Phobius details amino acids 481 to 508 (28 residues), see Phobius details amino acids 529 to 554 (26 residues), see Phobius details amino acids 881 to 900 (20 residues), see Phobius details amino acids 907 to 927 (21 residues), see Phobius details amino acids 933 to 957 (25 residues), see Phobius details amino acids 981 to 1000 (20 residues), see Phobius details amino acids 1010 to 1033 (24 residues), see Phobius details TIGR00914: heavy metal efflux pump, CzcA family" amino acids 1 to 1042 (1042 residues), 1663.7 bits, see alignment E=0 PF00873: ACR_tran" amino acids 6 to 1035 (1030 residues), 1137.3 bits, see alignment E=0

Best Hits

Swiss-Prot: 73% identical to CZCA_ALCSC: Cation efflux system protein CzcA (czcA) from Alcaligenes sp. (strain CT14)

KEGG orthology group: K07239, heavy-metal exporter, HME family (inferred from 73% identity to ajs:Ajs_1849)

MetaCyc: 67% identical to cation efflux system protein (Pseudomonas putida KT2440)
RXN1G01-61; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcA; Cation efflux system protein CusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1056 amino acids)

>ABZR87_RS21705 CusA/CzcA family heavy metal efflux RND transporter (Ralstonia sp. UNC404CL21Col)
MFERLLRTVIAQRWLVLLAVLAAAAFGAYSYTRLSIDAVPDITNVQVQINTPAPGYSPLE
TEQRITYALETAMAGLPKLEQTRSLSRYGLSQVTVIFKEGTDIYFARQLVSERLQAAKEQ
LPDGISPSMGPVSTGLGEIYLWTVEADANARKPDGTAYTPADLRELQDWVIRPQIRNVPG
VTEVNTIGGFAKEFLVATSPERLASYKLTLADVVTALDRNNANVGAGYIERKGEQYLVRA
PGQLRDAADIGNVVLASPNGTPVRLRDVASIESGSELRTGAATSNGREVVLGTAFLLMGE
NSRTVSQAVDKRMQEIRKTLPAGIRVESVYDRTVLVDKAIATVKKNLLEGAILVMAVLFL
FLGNLRAAVLTALVIPLSMLMTFSGMVSAKVSANLMSLGALDFGIIVDGAVVIVENCVRR
LAHAQELRGRPLTRAERFDEVFEAAREARRPLLYGQLIIMVVYLPIFALSGVEGKMFHPM
AITVVLALAAAMILSITFVPAAVALFIGERVAEKENRLMGWARRMYAPLLERVLAAPAVV
LTFAAVAVSVSVVAATRLGAEFVPNLNEGDLSIQAMRVPGTGLAQSLDMQMQIERTLKTK
FPEIERVFARTGTAEVATDVMPPSISDGYIMLKPERDWPTGADGKRRNRDQLLADIRTTV
EALPGNAYEFSQPIQLRFNELISGVRSDVAVKLFGDDMSVLEAQAKRIAAQLGKLAGAAE
VKIEQTGGLPFLNVDIDRDKAARYGLSIGAIQDTVSAAIGGKDAGTVFQGDRRFGIVVRL
PETARSDPAALGRLPLALPNGQGYVPLSEVATLNEVTGPNQVSREDGKRRIVVSANVRGR
DIASFVEEAQAVLDAQVRLPAGYWMAWGGQFEQLQSATGRLQIVVPLALAMVFTLLFMMF
GNLKDGLLVFSGIPFALSGGILALALRGIPLSISAAVGFIALSGVAVLNGLVMLSFIRSL
RESGKPVDEAVREGALTRLRPVLMTALVASLGFVPMALATGTGAEVQRPLATVVIGGILS
STALTLLVLPVLYRLAYRRGAQPGRGDAPAPEASSA