Protein Info for ABZR87_RS21620 in Ralstonia sp. UNC404CL21Col

Annotation: Nramp family divalent metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 64 to 90 (27 residues), see Phobius details amino acids 111 to 137 (27 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 326 to 326 (1 residues), see Phobius details amino acids 351 to 369 (19 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details amino acids 416 to 436 (21 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 31 to 405 (375 residues), 365.3 bits, see alignment E=2.4e-113 PF01566: Nramp" amino acids 53 to 411 (359 residues), 453.7 bits, see alignment E=2.2e-140

Best Hits

Swiss-Prot: 87% identical to MNTH_RALSO: Divalent metal cation transporter MntH (mntH) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03322, manganese transport protein (inferred from 87% identity to rso:RS00399)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>ABZR87_RS21620 Nramp family divalent metal transporter (Ralstonia sp. UNC404CL21Col)
MFRLPTTATAPFCPSEVRGTVAVPPGLPLWKKLLRFAGPGLLVSVGYMDPGNWATDIEAG
SRYGYALLFVVVLSSLAAMVLQCLSARLGIVTGMDLARASRNRYQPGALRVQWLLAELSI
IACDLAEVLGCALAFHLLLGVPILWGVALTALDTLIVLGLKGKNFRQLEAIVLGLILTIG
LCYFVELVLIKPHWPSVAAGLVPSWQAVSQREPLYLAIGILGATVMPHNLYLHSSIVQTR
MTANTEAAKREAIGLSRLDTIVSLGLALLVNGAILILAAAAFNAHGHQNVADIQDAYHLL
EPVVGTALAGLLFGIALLAAGQSSTFTGTIAGQILMEGFLDLSIPCWQRRLITRALALIP
AFIGVAMLGDHAIGKLLVISQVVLGLQLPFAMFPLIRMTGDRTLMGVFVNTRFTSWLAWG
LFVVIGVANVWLVWQVLTG