Protein Info for ABZR87_RS21390 in Ralstonia sp. UNC404CL21Col

Annotation: Nramp family divalent metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 33 to 50 (18 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 131 to 161 (31 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 214 to 238 (25 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 407 to 430 (24 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 34 to 394 (361 residues), 313.3 bits, see alignment E=1.5e-97 PF01566: Nramp" amino acids 56 to 404 (349 residues), 381.5 bits, see alignment E=2e-118

Best Hits

Swiss-Prot: 56% identical to MNTH_VEREI: Divalent metal cation transporter MntH (mntH) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: K03322, manganese transport protein (inferred from 56% identity to vei:Veis_4401)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>ABZR87_RS21390 Nramp family divalent metal transporter (Ralstonia sp. UNC404CL21Col)
MDDALALERDSSSASRSVVAQARAALEGRRRGWRTFTPFVGPAVVVSVAYTDPGNIATGI
EAGARYGYQLLWVVLASSLVAMLFQMLSARVGIVTGQNLAQLCRTHLPAPAGLGMWFVSE
LAAMATDLAEFVGAAVGIALLTGMPLLHAMVIAGVLTYLLLMLQGRGFRSVELMIGALVA
VIGISYIIQVWILPVSWAAALRQTFVPTALPPDAFMLAAGIVGATVMPHALFLHSGLVNT
RVRPRSASETSQLLRYSNREVVAALAAAGCINLAMVVVSAGAFHGAHAEVAGIEDAYITL
APLFGASAGLVFLVGLIASGLSSSVVGTMAGQMVLQGFLRVRLPVWMRRLITMVPAFIVI
GAGMDVTRALVLSQVVLSMVVPFPMAALIWLARRPDLMGQHAATRGLVRLATVGAVLVAG
LNGALLVHLIA