Protein Info for ABZR87_RS21230 in Ralstonia sp. UNC404CL21Col

Annotation: 3-oxoadipate enol-lactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02427: 3-oxoadipate enol-lactonase
  • amino acids 17 to 265 (249 residues), 266.9 bits, E=8.1e-84
• PF00561: Abhydrolase_1
  • amino acids 29 to 252 (224 residues), 95.2 bits, E=1.1e-30
• PF12697: Abhydrolase_6
  • amino acids 37 to 260 (224 residues), 65.4 bits, E=2.5e-21
• PF03096: Ndr
  • amino acids 47 to 265 (219 residues), 36.8 bits, E=3.9e-13
• PF12146: Hydrolase_4
  • amino acids 53 to 241 (189 residues), 57.3 bits, E=3e-19

Best Hits

Swiss-Prot: 40% identical to ELH2_ACIAD: 3-oxoadipate enol-lactonase 2 (catD) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 67% identity to mci:Mesci_2298)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• superpathway of salicylate degradation (7/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• 4-methylcatechol degradation (ortho cleavage) (4/7 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (18/35 steps found)
• superpathway of aerobic toluene degradation (9/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Protein Sequence (271 amino acids)

>ABZR87_RS21230 3-oxoadipate enol-lactonase (Ralstonia sp. UNC404CL21Col)
MTTRNDLSFFTAGDGTRLAYRFDGTAGKPVLLLSNSIGTDLHMWDVTVPRLAEHFHVLRY
DARGHGASDAPAGAYSIDRLGRDVVELLDALGIQRVHMLGLSLGGIVAQWLAIHVPERID
RLILSNTAAHIGPTQYFDQAIAELQQAPDMQATTETFLRNWFPARMLEANDPAVAPFRRT
LLATPREGIIGGWAAVRDADLRRTITLITHPTLVIAGQHDTVTSARHGEEIAAAIPGAQL
RLLDTVHLANVEQPDAFVEAVLDFLGVHETV