Protein Info for ABZR87_RS21195 in Ralstonia sp. UNC404CL21Col

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 30 to 136 (107 residues), 51 bits, see alignment E=8.2e-18 PF00528: BPD_transp_1" amino acids 51 to 241 (191 residues), 69.3 bits, see alignment E=1.9e-23

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 83% identity to rsl:RPSI07_mp0515)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>ABZR87_RS21195 amino acid ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MTDDLLARAIALVRHTGLDYSFLTEAYERNALLQGAKVSLLVMLSTVVLSLIFGVGLARL
LVSPHKRVRWLAQGFIELTRNTPTLVQLCCAFLVVNTLITQTLAQWQLTNPLTPFFWAVT
LLSLHKAAFHAEALRAGIEAVPPAMLEAATSLGFSARERLWRVQLPLALRAAWPSLMNNT
VELVKASSLASAIAVGDLTYSALMIWTQRDNVLECMVLLLLFYGVVTYAVHALGAWIERR
LQMPGYGAAGHAALGSAAHA