Protein Info for ABZR87_RS21155 in Ralstonia sp. UNC404CL21Col

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 267 to 300 (34 residues), see Phobius details amino acids 319 to 342 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 331 (281 residues), 126.4 bits, see alignment E=5.9e-41

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 79% identity to vpe:Varpa_3477)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>ABZR87_RS21155 branched-chain amino acid ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MSTALDAPSGHTTRPSTARTHLSWPAWATPAVTLLLAYFVVPLVASDYWLDAILIPFLAL
SLAAVGLNLLTGYAGQLSAGSAAFMAVGAFAAYNFNLRVDGLPLPVSIVLAGLAATAIGV
AFGLPSLRLRGFYLAVSTLAAQFFVQWALTKYGWFSNNNASGVIDAPPIVVAGFAFDTPA
LRYVFALTVVAILTALVWRLVQTPTGHHFIAVRDNEMAARVTGVPVLRTKLLAFAISSFV
IGVAGVLWGFIYLRTVEPAGFNLDRSFQILFIVIIGGLATIRGAFLGAALVVVFPLLLSR
FGAFVFGSRFDSGVRDLSQRIVIGALIVAFLIAEPQGLAALWQRVLRRIGNVVRPASRR