Protein Info for ABZR87_RS21135 in Ralstonia sp. UNC404CL21Col

Annotation: FMN reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR03566: FMN reductase" amino acids 6 to 177 (172 residues), 261.9 bits, see alignment E=1.3e-82 PF02525: Flavodoxin_2" amino acids 6 to 131 (126 residues), 34.5 bits, see alignment E=1.7e-12 PF03358: FMN_red" amino acids 6 to 150 (145 residues), 101.8 bits, see alignment E=2.7e-33

Best Hits

Swiss-Prot: 65% identical to SFNF_PSEPF: NADH-dependent FMN reductase SfnF (sfnF) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00299, FMN reductase [EC: 1.5.1.29] (inferred from 72% identity to vpe:Varpa_3481)

Predicted SEED Role

"FMN reductase (EC 1.5.1.29)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.5.1.29)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.29

Use Curated BLAST to search for 1.5.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>ABZR87_RS21135 FMN reductase (Ralstonia sp. UNC404CL21Col)
MSRKFKVVAVSGSVQRPSRTLVLVEQLLAALAEVLPIDVHLITLEELAPAIGGTSYRDQL
PGRVQAELAAIESADVLVVASPVYRGSYTGLFKHLFDLVHHEALIDVPVLLAATGGSDRH
ALVIDHQLRPLFSFFQARTLPLGVYASEQDFSGYDITSQALRDRIALAVTRALPLLSTAP
AADLRTAPVAQAA