Protein Info for ABZR87_RS20945 in Ralstonia sp. UNC404CL21Col

Annotation: DNA-3-methyladenine glycosylase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR00624: DNA-3-methyladenine glycosylase I" amino acids 3 to 181 (179 residues), 234.7 bits, see alignment E=3e-74 PF03352: Adenine_glyco" amino acids 6 to 181 (176 residues), 268.4 bits, see alignment E=1.5e-84

Best Hits

Swiss-Prot: 48% identical to 3MGA_HAEIN: DNA-3-methyladenine glycosylase (tag) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01246, DNA-3-methyladenine glycosylase I [EC: 3.2.2.20] (inferred from 88% identity to rsl:RPSI07_mp0564)

Predicted SEED Role

"DNA-3-methyladenine glycosylase (EC 3.2.2.20)" in subsystem DNA Repair Base Excision (EC 3.2.2.20)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>ABZR87_RS20945 DNA-3-methyladenine glycosylase I (Ralstonia sp. UNC404CL21Col)
MARCCWAGEDPLMIEYHDTEWGVPSHDDRHLYEMLILEGAQAGLSWQTILRKRARYQEVF
EGFDAARVARFTPARIEKLLADPGIVRNRAKVEGAVINARKVLELQEEMGSLDAFLWSFV
DGKTIVNRWDSYRDAPAATDASKAMSKALIKRGFKFVGPTICYAFMQATGMVDDHEAGCF
RAGKA