Protein Info for ABZR87_RS20935 in Ralstonia sp. UNC404CL21Col

Annotation: CynX/NimT family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 94 to 111 (18 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 223 to 247 (25 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details PF07690: MFS_1" amino acids 43 to 361 (319 residues), 82.3 bits, see alignment E=1.6e-27

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 92% identity to rpf:Rpic12D_3476)

Predicted SEED Role

"MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>ABZR87_RS20935 CynX/NimT family MFS transporter (Ralstonia sp. UNC404CL21Col)
MSHTPHSPPPPAAHDTAAPRSSGALILLVVGLVLVGVNLRPALSSLSPVLKQVTAGTGLS
GATAGLLTTLPVLCLGLFAPAAAVLARRFGAERAVGGLLIALAAGIALRSAGGVAPLFIG
TLAAGACIGVTGILLPGIVKRDFGRQADLMTGVYTMALCFGAAVAAGASAPLSAWLGGWQ
PALAFWALPALLAFVGWWPHMRHAHGKGAATRLQRVSLWNKPIAWQVTLHMGLQSSLAYC
VFGWLPVILQDRGLSAVQSGVVVAVSILVQLVTALGGPFVARLGRDQRPAVVLMMLMCWA
GLMGCLYAPLSTLWWWAVLLGLGQGGNFSVALSLIVLRSADARVAASLSAMTQGIGYTMA
AAGPYLMGVLHDLTGSWAVMGWLFSAIALASLVAGSLAGRNRTLHAGE