Protein Info for ABZR87_RS20845 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details amino acids 395 to 418 (24 residues), see Phobius details amino acids 425 to 449 (25 residues), see Phobius details PF07690: MFS_1" amino acids 39 to 212 (174 residues), 119.3 bits, see alignment E=5.7e-38 amino acids 273 to 461 (189 residues), 70.9 bits, see alignment E=2.8e-23 PF06609: TRI12" amino acids 41 to 230 (190 residues), 25.7 bits, see alignment E=1.2e-09 PF06779: MFS_4" amino acids 55 to 210 (156 residues), 28.5 bits, see alignment E=3e-10 PF00083: Sugar_tr" amino acids 68 to 442 (375 residues), 91.5 bits, see alignment E=1.7e-29 PF05977: MFS_3" amino acids 74 to 207 (134 residues), 33.5 bits, see alignment E=5e-12

Best Hits

Swiss-Prot: 40% identical to PCAK_PSEAE: 4-hydroxybenzoate transporter PcaK (pcaK) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K08195, MFS transporter, AAHS family, 4-hydroxybenzoate transporter (inferred from 66% identity to hse:Hsero_1116)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>ABZR87_RS20845 MFS transporter (Ralstonia sp. UNC404CL21Col)
MRPAPAVHEAPSAPIDLARLIDQGKVGGFQILLLAICGLCLIIDGFDVQAMGYVAPAIIK
DWNITKASLGPVFGAGLFGMLVGSLVFGVLGDRFGRRPVLIVATFFFAACMLATTQVETV
NALLILRFVTGLGLGCIMPNAMALAGEFSPARTRVTWMMLVSCGFTVGAALGGFVSAALL
SRFGWHAVFLVGGLVPLVIGVMMVLWLPESLQYLVLKGDPQTRHQRLARWLGKLAPQLQV
NAQTQFVVPEAAARGMPVSALFTEGRAKVTLVLWVINFMNLIDLYFLSNWLPTLIRDAGY
PTDTAVLVATALQVGGVIGTLTLGRLIDRLGFVRVLAVCFLIACVTVGLIGHVAAALPVL
VAVVFVAGFCIVGGQPAVNALAATYYPTTLRATGIGWSLGVGRIGSVIGPVIGGQLIAMQ
WSGPALFSAAAVPAMVSFGMVLALTLAASGPDAARFASRRATGKPA