Protein Info for ABZR87_RS20815 in Ralstonia sp. UNC404CL21Col

Annotation: 5-dehydro-4-deoxy-D-glucuronate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 90% identical to KDUI_BURCJ: 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (kduI) from Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)

KEGG orthology group: K01815, 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase [EC: 5.3.1.17] (inferred from 90% identity to bcj:BCAM0154)

MetaCyc: 72% identical to 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase subunit (Dickeya dadantii 3937)
4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase. [EC: 5.3.1.17]

Predicted SEED Role

"4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 5.3.1.17)

MetaCyc Pathways

4-deoxy-L-threo-hex-4-enopyranuronate degradation (4/5 steps found)
superpathway of microbial D-galacturonate and D-glucuronate degradation (17/31 steps found)

KEGG Metabolic Maps

Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>ABZR87_RS20815 5-dehydro-4-deoxy-D-glucuronate isomerase (Ralstonia sp. UNC404CL21Col)
MEVRQGIHSEHAKTLDTAGLRRQFLVEQVFERDALQLTYSHIDRIIVGGAWPATRPVEVP
ASLAKSMGVSHLLERRELGAINIGGAGWVEVDGTRHAVGNEEAIYIGQGGQNIVFGSDDA
ARPAKFYINCAPAHTAYPTRTITLAQASPETLGDPATSNRRTIYKFIVPDVLPTCQLSMG
MTKLEPGSLWNTMPCHTHERRMEVYFYFNLPDNAAVFHMLGEPQETRHILVHNEQAVISP
SWSIHSGVGTQAYTFIWGMVGENQVFHDMDHIAIADLR