Protein Info for ABZR87_RS20810 in Ralstonia sp. UNC404CL21Col

Annotation: 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01832: 2-deoxy-D-gluconate 3-dehydrogenase
  • amino acids 14 to 261 (248 residues), 418.8 bits, E=3.6e-130
• PF00106: adh_short
  • amino acids 19 to 211 (193 residues), 193.6 bits, E=3.9e-61
• PF08659: KR
  • amino acids 22 to 169 (148 residues), 32.4 bits, E=1.3e-11
• PF13561: adh_short_C2
  • amino acids 27 to 258 (232 residues), 202.4 bits, E=1.3e-63

Best Hits

Swiss-Prot: 68% identical to KDUD_DICD3: 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (kduD) from Dickeya dadantii (strain 3937)

KEGG orthology group: K00065, 2-deoxy-D-gluconate 3-dehydrogenase [EC: 1.1.1.125] (inferred from 82% identity to bcj:BCAM0155)

MetaCyc: 68% identical to KduD (Dickeya dadantii 3937)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (4/5 steps found)
• 2-deoxy-D-glucose 6-phosphate degradation (2/4 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (17/31 steps found)

KEGG Metabolic Maps

• Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.125 or 1.1.1.127

Protein Sequence (261 amino acids)

>ABZR87_RS20810 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD (Ralstonia sp. UNC404CL21Col)
MRLENPYLQSASLFDLTGKVAIVTGSNTGLGAGMATALAAAGCDIVGANRSDPAETAARV
EAAGRRFVDVRADLSSLAPIGSIVEAAMDTFGRVDILVNNAGIIRRCDALEFSEADWDAV
IDVNLKGVFFLSQAVARQFVQQGGRGKIINVASMLSFQGGIRVPSYTASKSGVLGLTRLL
ANEWAGRGINVNAIAPGYMETDNTAQLREDRQRSEEILARIPAGRWGVPDDLAGAVVFLA
SAASDYVHGHTLAVDGGWLAR