Protein Info for ABZR87_RS20760 in Ralstonia sp. UNC404CL21Col

Annotation: branched-chain amino acid ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 258 to 283 (26 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 45 to 313 (269 residues), 117.8 bits, see alignment E=7.5e-38 PF00005: ABC_tran" amino acids 372 to 535 (164 residues), 110.4 bits, see alignment E=1.7e-35 PF12399: BCA_ABC_TP_C" amino acids 584 to 606 (23 residues), 42.1 bits, see alignment (E = 7.8e-15)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein K01998, branched-chain amino acid transport system permease protein (inferred from 94% identity to rsl:RPSI07_mp0604)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (608 amino acids)

>ABZR87_RS20760 branched-chain amino acid ABC transporter ATP-binding protein/permease (Ralstonia sp. UNC404CL21Col)
MNTLTKSSEGTAQRGWLSRNRVLTALFVVVLVLIPIVPTPEFWITLLNYIGLYSLVALGL
VLLTGVGGLTSFGQAAFVGLGAYSTAYLTTQYGVSPWIGLLAGLAITVVSAYVIGLITMR
MSGHYLPLATIAWGLSLFFLFGNLEFLGKYDGLNGIPVLNVLGKSLQTGREMFYLIWAVV
VVAVLAVQNLLNSRPGRAIRALKGGGTMAEAMGVNTAWMKVVIFVFAAVLACISGFLYAH
LQRAVNPTPFGLNYGIEYLFMAVVGGVGHVWGAVLGAGLLTILKDSLQSVLPKLLGSNGN
FEIIVFGVLLVLLLQYARDGVWPFIRKLFPSAPTAHAPDDAPALKQREKPQAGELILDVR
AARKEFGGLVAVNDVSFQVKAGEIIGLIGPNGAGKSTTFNLVTGVLPVTRGEVLYRGERI
SGKPSREIVKRGIGRTFQHVQLLSGMTVLENVALGAHLRGDFAAQGGVLASVVRMNQAEE
QKLLFEARRQLERVGLADCMYQEAGSLALGQQRILEIARALCCDPALLLLDEPAAGLRYK
EKQALAALLTKLKAEGMSVLLVEHDMDFVMNLTDRLVVMEFGTKIAEGLPQEVQQNPAVL
EAYLGGVE