Protein Info for ABZR87_RS20550 in Ralstonia sp. UNC404CL21Col

Annotation: SLC13 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 95 to 123 (29 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details amino acids 217 to 251 (35 residues), see Phobius details amino acids 255 to 256 (2 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 325 to 350 (26 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details PF03600: CitMHS" amino acids 34 to 319 (286 residues), 117.5 bits, see alignment E=3.6e-38

Best Hits

Swiss-Prot: 48% identical to YBIR_ECOLI: Inner membrane protein YbiR (ybiR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_4486)

Predicted SEED Role

"Arsenical pump membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>ABZR87_RS20550 SLC13 family permease (Ralstonia sp. UNC404CL21Col)
MHGDPPRKHMAQAVPQHPPFWHNLKQDVFFWALLVICGVLTLVAPKRIVEYPSLIDWHTI
AALAGLLILTKAVEASGMLQLLGRRLVEVVSSQRVLALSLVAASAALSTVLTNDVALFVI
VPLTVGLRQVASLPVARLVIFEALAVNAGSALTPIGNPQNLFLWHQSGLSFGAFVWQMAP
MVVLLMALLLAATWLAFASHEIHLHAETADVELHKRLLVPALLLYVPFLVLTDLGHPLVA
AAGLIVLYLIGARYVLARVDWGLLLVFMLMFIDLRLVAQLGIVRQALDALALSNPMHLYW
AGIGVSQIISNVPAAILLAEYSHDWPMIAFAVSVGGFGTLIGSLANLIALRMLGDRRAWW
VFHAYSMPFLLAAAGIVYAWLMWLR