Protein Info for ABZR87_RS20425 in Ralstonia sp. UNC404CL21Col

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details PF17152: CHASE8" amino acids 45 to 148 (104 residues), 62.1 bits, see alignment E=7.9e-21 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 196 to 367 (172 residues), 122.1 bits, see alignment E=9.9e-40 PF00990: GGDEF" amino acids 199 to 365 (167 residues), 145.3 bits, see alignment E=2.2e-46 PF00563: EAL" amino acids 386 to 629 (244 residues), 249.3 bits, see alignment E=5.4e-78

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpi:Rpic_4466)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (670 amino acids)

>ABZR87_RS20425 EAL domain-containing protein (Ralstonia sp. UNC404CL21Col)
MSESITTSRPRLGHSVVRANMAGAGAALTIAGFLLIVFQFIALHAALVRDVHVQARIVGA
NSVAALLFNDRRAAEETLAALEASPSLRAAGIFSALRKPLALYQHGDAAPVRAPDAAMLR
ESDVSTLTTLEVVEPVESERRVIGYVVVRSSLSELYMQLLGYAVLTVSVGIGAMGLAYLV
IARMRRAVLQAEAHLDYLAHIDSVTELPNRHAFNERLQVSLKRAGQTGAVGLLLLDLDNF
KVVNDTLGHNNGDRLLRQVARRLNDVIDQANLRAVLCRIGGDEFAVIAELSGRAQIAETE
AATLADGLAKRVLAALAAPFALDLHQIYVTASVGVSLYPHDARDVQVLTRNADTAMYHAK
NRGKNAAASFTSEMDQQARRRLRVEADLRRALDRDELLLAYQPQVRLRTEGAHDAAISKA
NVYGVEALVRWRHPEIGLIGPGEFIAVAEETGLIVPLGLWVLRTACQQAVRWMREDGITL
RVAVNLSARQTRDPALVENVMDVLRETGLPPHQLELEITESVLMEDIEANIALLESLHAA
GISLSIDDFGTGYSSLAYLQRFPIQKLKIDRSFVQRMPGDGEAIAGAVIAMAHSLRMQVV
AEGVEDPEQLALLRDAGCDLGQGYLFSRPQQADALLAWLNRLDSAEDEGSAAFADGEAAP
SASLPSSLAG