Protein Info for ABZR87_RS20315 in Ralstonia sp. UNC404CL21Col

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 21 to 170 (150 residues), 30.1 bits, E=8.1e-11
• PF01370: Epimerase
  • amino acids 23 to 186 (164 residues), 79.6 bits, E=7.4e-26
• PF01073: 3Beta_HSD
  • amino acids 24 to 162 (139 residues), 44 bits, E=4.4e-15
• PF13460: NAD_binding_10
  • amino acids 26 to 128 (103 residues), 31.7 bits, E=4.2e-11
• PF16363: GDP_Man_Dehyd
  • amino acids 43 to 179 (137 residues), 50.5 bits, E=6.5e-17
• PF07993: NAD_binding_4
  • amino acids 72 to 181 (110 residues), 26.4 bits, E=1.1e-09

Best Hits

Swiss-Prot: 67% identical to URODH_PSEPK: Uronate dehydrogenase (udh) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 96% identity to rpf:Rpic12D_4581)

MetaCyc: 65% identical to uronic acid dehydrogenase subunit (Pseudomonas syringae)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• D-galacturonate degradation III (2/2 steps found)
• D-glucuronate degradation III (2/2 steps found)
• D-glucuronate degradation II (4/5 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galacturonate degradation II (3/5 steps found)
• colanic acid building blocks biosynthesis (7/11 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (17/31 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.203 or 5.1.3.2

Protein Sequence (281 amino acids)

>ABZR87_RS20315 NAD(P)-dependent oxidoreductase (Ralstonia sp. UNC404CL21Col)
MTTEMNLQNDPLDGVTTRCHRLLLTGAAGNLGKVLRERLPKYADSLRLSDISNLGEARTG
EEIVPCNLADAKAVDALVAGTDAIVHLGGVSVERPFEEILPANIAGTYNLYEAARRHGVR
RIVFASSNHTIGFYKQGEVIDSTVPTKPDGYYGLSKVFGEQLASFYFDRYGIETVAIRIG
SSFAEAKDRRMLVTWLGYDDLEQLIRRALFVPSVGFTVVYGMSNNRDHWWDNRHAAHLGY
QPTQTSEIFRAQVEAQPPLPADDPAALYQGGAFVKAGPFGD