Protein Info for ABZR87_RS20295 in Ralstonia sp. UNC404CL21Col

Annotation: MHYT domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details PF03707: MHYT" amino acids 64 to 118 (55 residues), 62.3 bits, see alignment E=1.7e-21 amino acids 128 to 183 (56 residues), 62.4 bits, see alignment E=1.6e-21 amino acids 190 to 252 (63 residues), 25.7 bits, see alignment E=4.7e-10

Best Hits

KEGG orthology group: None (inferred from 77% identity to rsl:RPSI07_mp0782)

Predicted SEED Role

"FIG00978227: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>ABZR87_RS20295 MHYT domain-containing protein (Ralstonia sp. UNC404CL21Col)
MFYGFSAVPGAIVPYAYDWLLVGLSYLISVAGAYVGLRWSRRVRNKNGTLDMDRLICASV
ALGGGAVWSMHFIGMAAYRTPVRIEFDLFMTMLSLVVVMVFAAGGLVIASRTTGNRLRNI
AEGGVLTGLGVAVMHYTGMAAVHTNSNFDWDISIIGVSALIAVVVSMVALWLATTVKTRG
QQFGAALIMGVAVCGMHYTGMTAGTMICTGQSYSPSLFAIEGSNIGYAVFALAGTILMII
LLIEASRSASSARATASGTLR