Protein Info for ABZR87_RS20235 in Ralstonia sp. UNC404CL21Col

Annotation: type VI secretion system contractile sheath large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 TIGR03355: type VI secretion protein, EvpB/VC_A0108 family" amino acids 17 to 489 (473 residues), 735.8 bits, see alignment E=1.1e-225 PF05943: VipB" amino acids 66 to 368 (303 residues), 457.8 bits, see alignment E=1.6e-141 PF18945: VipB_2" amino acids 378 to 488 (111 residues), 156.3 bits, see alignment E=3.2e-50

Best Hits

KEGG orthology group: K11900, type VI secretion system protein ImpC (inferred from 90% identity to rsl:RPSI07_mp0657)

Predicted SEED Role

"Uncharacterized protein ImpC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>ABZR87_RS20235 type VI secretion system contractile sheath large subunit (Ralstonia sp. UNC404CL21Col)
MLENQSAAQGASVAEEVSLLDSIVEQSRVAKSDSERERAKDIIGELASQVLSGTVVVSDN
LSATLDARVAELDRLISQQLSAIMHAPEFQKLESTWRGLHYLVKETSTGQTIKIKALNAT
KRDLTKDFKTAIEFDQSALFKKVYEEEFGTFGGAPFGALIGDYEITRQPEDMYFIEQMAH
VAAASHAPFIASSSPELLGLESFADLGKPRDLAKVFDTVEYAKWKSFRDSEDSRYVGLTL
PRFLGRLPYNPKDGTVVESFNFVEDVDGTDHSKYLWCNAAWAFGARLTAAFDDFGWCAAI
RGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFIPLVHCKNTDYAA
FFAAQSAQKAKKYDSDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAKNVET
FLNRWISQYVLLDDNATQEQKAQFPLREASIQVAEVPGKPGTYRSVAFLRPHFQLDELSI
SLRLVADLPKSANS