Protein Info for ABZR87_RS20060 in Ralstonia sp. UNC404CL21Col

Annotation: universal stress protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 37 to 42 (6 residues), see Phobius details PF00582: Usp" amino acids 3 to 144 (142 residues), 50.1 bits, see alignment E=2.2e-17 amino acids 154 to 277 (124 residues), 47.8 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: None (inferred from 91% identity to rpi:Rpic_4433)

Predicted SEED Role

"Universal stress protein UspA and related nucleotide-binding proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>ABZR87_RS20060 universal stress protein (Ralstonia sp. UNC404CL21Col)
MTYASVMVHLDRSERAMHRLNLAALYARAHNAKLVGIYASFAPSISWFYMMENAARYLEE
DRIRRDSIRDAVHARFRLAIEGLPVETEWRAVEGDPVALALREAREADLLVVGQRNHDEP
DEFVAGDFVETLILESGRPVLVVPYAGSFTTLPKRVLVAWSGGRESARALHDAIPIMAGA
NAHVLQITSTQPKHWAEETTVGQVARALNARGIHATVEETDCADSDTAIGELLLSRAADF
NADLIVMGAYGHSRLRELVLGGVTRTLLKTMTVPVLMSH