Protein Info for ABZR87_RS19985 in Ralstonia sp. UNC404CL21Col

Annotation: ribose-phosphate pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF13793: Pribosyltran_N" amino acids 23 to 123 (101 residues), 53.2 bits, see alignment E=4e-18 TIGR01251: ribose-phosphate diphosphokinase" amino acids 26 to 286 (261 residues), 169.7 bits, see alignment E=3.6e-54 PF00156: Pribosyltran" amino acids 159 to 289 (131 residues), 45.4 bits, see alignment E=8.5e-16

Best Hits

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 88% identity to rpi:Rpic_4380)

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.1

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>ABZR87_RS19985 ribose-phosphate pyrophosphokinase (Ralstonia sp. UNC404CL21Col)
MTAPAVGLDPQRVLIAMPGCEAATMRLAIPLSAELGHAAVTHFPDGESYVRLYTPVHGAE
VAIVCTLDHPDEKLLPLLWLAIAARQGGARRVGLIAPYLPYMRQDVVFNAGEIRAAEHFA
ALLNPAFNWLVTVDPHLHRLAHLSDVYRIPTVAVQAAPAIAAWIQTHVQAPFLIGPDDES
RQWVQHVAGICKAPWAALAKTRHSAWHVEITEVPTIPAGYVPVLVDDIISTGRTMLAAAA
LLQRAGQRQPICVGVHAVFAADAYSRLCAASADVVTCDTIPHPSNQVALTEPLVDAVSRM
FDLPLPSNKPMLV