Protein Info for ABZR87_RS19975 in Ralstonia sp. UNC404CL21Col

Annotation: thymidine phosphorylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 TIGR02645: putative thymidine phosphorylase" amino acids 19 to 509 (491 residues), 689.4 bits, see alignment E=1.1e-211 PF02885: Glycos_trans_3N" amino acids 111 to 171 (61 residues), 43.4 bits, see alignment E=3.5e-15 PF07831: PYNP_C" amino acids 441 to 501 (61 residues), 41.9 bits, see alignment E=9.5e-15

Best Hits

Swiss-Prot: 84% identical to TYPH_RALSO: Putative thymidine phosphorylase (RSc0204) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00758, thymidine phosphorylase [EC: 2.4.2.4] (inferred from 94% identity to rpi:Rpic_4378)

Predicted SEED Role

"Thymidine phosphorylase (EC 2.4.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 2.4.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>ABZR87_RS19975 thymidine phosphorylase family protein (Ralstonia sp. UNC404CL21Col)
MSTVSVPSLDAPLAPQGCLRFKALGIDTWQEHVIYMHPDSAVCRSEGFAAQARVEVQIGQ
RSAIATLNLVGSGLLEKHEVSLSASAVDALMARPGDEVCVRHAPSLESLRALRAKIYGAH
LDAKQLQDIVADISHERYADVHIAAFLSACSSGRMTIKETIDLTQAMVDAGERLQWDRAV
VADKHCVGGLPGNRTSPIVVAICAAAGLLLPKTSSRAITSPAGTADMMETLTRVNLSAAE
LRSVVGQVGASLAWGGALSLSPADDVLIRVERALDVDSDAQLVASILSKKIAAGSTHVLI
DVPVGPTAKVRSVEDLERLEMLLKRVAQAFDVQVLMVRTDGAQPVGRGIGPALEARDVLA
VLQRSPTAPFDLRERSLLLAGALLEFCGAGIAGTGLDMATGLLDSGAAWRKFEAICEAQG
GLRIPGEAVFRRDVVAEQNGIVTNIDNRHLARIAKLAGAPMRQVAGVQMHVRLRDQVSVG
QPLFTIHAQASGELEYSSAYALAHAAVDLSPMGIS