Protein Info for ABZR87_RS19910 in Ralstonia sp. UNC404CL21Col

Annotation: bifunctional enoyl-CoA hydratase/phosphate acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01575: MaoC_dehydratas
  • amino acids 39 to 135 (97 residues), 83.2 bits, E=1.7e-27
• PF13452: MaoC_dehydrat_N
  • amino acids 40 to 128 (89 residues), 33 bits, E=9.2e-12
• PF01515: PTA_PTB
  • amino acids 255 to 469 (215 residues), 152.3 bits, E=3.3e-48

Best Hits

KEGG orthology group: K00634, phosphate butyryltransferase [EC: 2.3.1.19] (inferred from 96% identity to rpi:Rpic_4316)

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or MLST or Propanediol utilization or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.3.1.8)

MetaCyc Pathways

• heterolactic fermentation (15/18 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• superpathway of L-threonine metabolism (14/18 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• L-threonine degradation I (5/6 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• mixed acid fermentation (12/16 steps found)
• ethanolamine utilization (4/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• acetyl-CoA fermentation to butanoate (5/7 steps found)
• pyruvate fermentation to acetate I (2/3 steps found)
• pyruvate fermentation to acetate IV (2/3 steps found)
• pyruvate fermentation to acetate VII (2/3 steps found)
• sulfoacetaldehyde degradation I (1/2 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• acetylene degradation (anaerobic) (3/5 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (11/17 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• sulfolactate degradation II (1/4 steps found)
• methanogenesis from acetate (2/6 steps found)
• superpathway of sulfolactate degradation (2/6 steps found)
• superpathway of taurine degradation (2/6 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (4/9 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (3/8 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)
• gallate degradation III (anaerobic) (5/11 steps found)
• L-lysine fermentation to acetate and butanoate (4/10 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)
• superpathway of methanogenesis (2/21 steps found)
• superpathway of L-lysine degradation (10/43 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Propanoate metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.19 or 2.3.1.8

Protein Sequence (481 amino acids)

>ABZR87_RS19910 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase (Ralstonia sp. UNC404CL21Col)
MSPDHLPAPPALLPGSDLSVVRNRTFDEIAVGDTVAILRTLTAEDIQLFAVLSGDVNPQH
LDPEFAASTRFHGVIAHGMLGGALISALLGTRLPGPGTIYLGQTLQFLAPVRVGDTLTIR
VTVVSKEEERKRVKLACTCTNDSGTVAIAGEAEVIAPTERIERPRTTLPDVRITTGSDGI
HRLLDHVRPMGAIHMAVVHPCDVLSLSAVMDARAEGLIVPCLVAPHAKLMRVAAEAGLDL
RGIEIEDVPHSSAAATRAVELVTQGRAEALMKGSLHTDELMAAVVREEAGLRTKRRISHC
FLMQSPAYPRPFIVTDAAINITPTLDQKADIVRNAIDLAHAIGVERPRVAILAAVETVNP
RMPATLDAAALCKMADRGQIEGGVLDGPLAFDNAVSAAAARIKGIVSEVAGQADVLVVPD
LESGNMLAKQLEYLGGAASAGIVLGARVPIVLTSRADSRESRIASCALATLLAHRYRNLP
P