Protein Info for ABZR87_RS19890 in Ralstonia sp. UNC404CL21Col

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 51 to 92 (42 residues), 25 bits, see alignment 1.9e-09 PF16576: HlyD_D23" amino acids 164 to 300 (137 residues), 40.9 bits, see alignment E=2.1e-14 PF13437: HlyD_3" amino acids 216 to 320 (105 residues), 49.7 bits, see alignment E=8e-17

Best Hits

Swiss-Prot: 54% identical to YHII_ECOLI: Uncharacterized protein YhiI (yhiI) from Escherichia coli (strain K12)

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 73% identity to hse:Hsero_1830)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>ABZR87_RS19890 efflux RND transporter periplasmic adaptor subunit (Ralstonia sp. UNC404CL21Col)
MTTTPQQRWIALLAAALVAAGAAFAWKALRQEGPGKGFVSGNGRIEATEIDVATKLPGRV
QDILVDEGDFVTAGQPLAHMQVQTLEAQRDEALARQQQSVSAVASAQAQVAVREADRQAA
LAQIALRESDLDAAQRRLARSETLSHEGASSMQELDDDRARVRSAKAALVAARAQAEAAQ
AAVLAARTQVAGAGATVKAADATVLRIKADIDDSALTAPRDARVQYRIAQPGEVLAGGGR
LLNLVDLSDVYMIFFVPETDAGRIAMGSEVRIVLDAAPQYVIPARVSFVASTAQFTPKTV
ETASERQKLMFRVKAQIDRDLLRKHLKLVKTGLPGVAWLKLDAQAEWPASLAIKVPQ