Protein Info for ABZR87_RS19805 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 58 (26 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 203 to 230 (28 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 342 (320 residues), 124.2 bits, see alignment E=6.1e-40 PF00083: Sugar_tr" amino acids 43 to 112 (70 residues), 31 bits, see alignment E=1.4e-11

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 92% identity to rpi:Rpic_4301)

Predicted SEED Role

"Multidrug resistance transporter, Bcr/CflA family" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>ABZR87_RS19805 MFS transporter (Ralstonia sp. UNC404CL21Col)
MTRRPLSFALLLPLLLSAQPVATDSYLPTLPAIAQTLGSASTSLTVFALAFGIGQLPMGS
LADRFGRRQVLLIGLACYAAAALAGALATTAFMLTAARALQGFSMAAILVCARAAVRDLH
PAREGPHVLARGLTGLGFVALVAPVLGAFVAQHAGWRWVLAGMSLYAIVLWAMCWYGFAE
TRRETGSEAGGVREIFSSADFRAWGLLAASTYAGIFCFLLLSPMVYIAYLGLSPELYGWI
PAGGSLVYILSTTGCRRLLRRQSLVRTVQQGATLSLVGAGIQGLGCWVLPGHAWPLLLGH
AVYCMGHGIHQPCGQAGAVGELPHLAGRAVSWSGFIMMLAAFCLGQTAAAFDDASHSLGA
WPMVAPMMLAGGALVAIAFLWLPKLQHRTNPQRAAA