Protein Info for ABZR87_RS19775 in Ralstonia sp. UNC404CL21Col

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF00892: EamA" amino acids 12 to 137 (126 residues), 47.2 bits, see alignment E=1.3e-16 amino acids 151 to 281 (131 residues), 55.3 bits, see alignment E=4e-19

Best Hits

KEGG orthology group: None (inferred from 95% identity to rpi:Rpic_4295)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>ABZR87_RS19775 DMT family transporter (Ralstonia sp. UNC404CL21Col)
MNDKTRGTVEMTAAMIISGTIGWFVVRSGQPVADVVFWRCVFGALTLLVVCAGLGLLRGA
ITWRRAGIAALGGVAIVINWLLLFAAYPRASISIATAVYNTQPFMLVGLGALFLSEKLTA
AKLTWLALAFIGVVLIVQVGPAASAGTDYLTGIAMALGAAFAYAVAALLIKKLAGTPPHL
IALIQVCVGVLMLAPLANLSHPPADAHAWVMLVTVGVVHTGLMYILLYGAIQRLPTHLTG
SLSFIYPIVAIAVDIVAFGHRLQLAQFLGAAAILLAAAGMNLGWSPYRWLRARSESAVSK