Protein Info for ABZR87_RS19750 in Ralstonia sp. UNC404CL21Col

Annotation: DNA-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09836: DUF2063
  • amino acids 9 to 85 (77 residues), 58.5 bits, E=3.2e-20

Best Hits

KEGG orthology group: None (inferred from 86% identity to rpf:Rpic12D_4400)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Protein Sequence (252 amino acids)

>ABZR87_RS19750 DNA-binding domain-containing protein (Ralstonia sp. UNC404CL21Col)
MRLPDWEAHLIGALTDPATNEETRGIAIYRNARLAILRNALAGAYPVCCALVGEDCFDAL
VRDTLAVQASTSPNLHRYGNALPAVIAQSPLAHSVPYLADVARLEWCVHWAHYAPDAHVE
AADATLLAQPADTIRAGLVEGVQWVASQWPVVSIWRAHQPGESIGFNQIDLGVGEAAAIA
VRGHRVAVLDLDPPSATFLAACEAETSLQAALETTLAERPDFDLTACLSGLYRSGLLALS
ACSTTSSTGDTP