Protein Info for ABZR87_RS19705 in Ralstonia sp. UNC404CL21Col

Annotation: APC family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 18 to 43 (26 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 79 to 111 (33 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 368 to 388 (21 residues), see Phobius details amino acids 397 to 420 (24 residues), see Phobius details amino acids 428 to 448 (21 residues), see Phobius details PF00324: AA_permease" amino acids 18 to 417 (400 residues), 54.2 bits, see alignment E=1.1e-18 PF13520: AA_permease_2" amino acids 28 to 424 (397 residues), 112.6 bits, see alignment E=2.3e-36

Best Hits

KEGG orthology group: None (inferred from 84% identity to rsl:RPSI07_mp1079)

Predicted SEED Role

"cell processes; transport of small molecules; amino acids, amines"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>ABZR87_RS19705 APC family permease (Ralstonia sp. UNC404CL21Col)
MAVDTQLEAHALGVSESVVMGVAGTAPAFSIAATTATLIGAVGALTPASLLYCGLIMFGV
TFAYLHLNRVNPHAGAAYAWVGAIFNRTLGFFAGWALLVASGVFMVSGTIPAATATLTLV
APSLAAQPAVVALVAAAWLLVVTAVIIKGIKLTSYSQIAMTVTETLILVCLIVLAVVKFG
AHPAHALSWALLSPAAFTPQLFATGALTALFFFWGWDVTVNLTEETRDANRAPGRGALWA
MVIVLALFMGFGAVILLVLSDAEIDQSSTNVIFAVADKLLPRPWSYVAVVAVMLSTVGTL
ETSILQFTRTLYAKGRDGMLHARYATLHPTWRTPWVATVVIAAIGLVLLFGASFFPSINA
IIKDSVNAIGFQVAFYYGLAGFACAWHYRREALRSVFNAVFLVGWPLGSALFLWLIAAYS
VPTFDLTTNLVGLGGIAVGAVPLLFNRWTAQRGARLARHR