Protein Info for ABZR87_RS19645 in Ralstonia sp. UNC404CL21Col

Annotation: 3-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00106: adh_short" amino acids 7 to 199 (193 residues), 185.7 bits, see alignment E=1e-58 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 7 to 261 (255 residues), 345.9 bits, see alignment E=5.9e-108 PF08659: KR" amino acids 10 to 174 (165 residues), 49.6 bits, see alignment E=7.1e-17 PF13561: adh_short_C2" amino acids 13 to 257 (245 residues), 170.7 bits, see alignment E=6.1e-54

Best Hits

Swiss-Prot: 34% identical to BUTA_STAAC: Diacetyl reductase [(S)-acetoin forming] (butA) from Staphylococcus aureus (strain COL)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 98% identity to rpf:Rpic12D_4380)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>ABZR87_RS19645 3-hydroxybutyrate dehydrogenase (Ralstonia sp. UNC404CL21Col)
MSDLKGKVAVVTGAASGIGKQIALTLADSGAAIAIVDLNEDGAKAVAKEITDAGGKAIGL
RMDVTDEQAVDSGIDRVAEEFGSVDILVSNAGIQIVNPFVSYSFADWKKMQAIHVDGAFL
TTRAALRHMCKDDRGGVVIYMGSVHSHEGSPLKSAYVAAKHALLGLNKVLAKEGAAHNVR
SHVVCPGFVRTPLVEKQIPEQAKELGISEEDVVKKVMLGDTVDGVFTTVEDVAETVRFLA
TFPSAALTGQSFVVSHGWFMQ