Protein Info for ABZR87_RS19620 in Ralstonia sp. UNC404CL21Col

Annotation: PepSY-associated TM helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 189 to 215 (27 residues), see Phobius details amino acids 333 to 360 (28 residues), see Phobius details PF03929: PepSY_TM" amino acids 7 to 362 (356 residues), 197.3 bits, see alignment E=2.7e-62

Best Hits

KEGG orthology group: K00380, sulfite reductase (NADPH) flavoprotein alpha-component [EC: 1.8.1.2] (inferred from 93% identity to rpf:Rpic12D_4375)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.2

Use Curated BLAST to search for 1.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>ABZR87_RS19620 PepSY-associated TM helix domain-containing protein (Ralstonia sp. UNC404CL21Col)
MLRRVLFRLHWLIGLSASVVLAIVGATGALMAYEDELLRALNPGVLTLPARSGPAPTLLQ
VAAQARAAMPKRPVTFITAASAPTEPWRVWYAWPPGKHGGSSRGELRYIDAATGTLLPEA
RAQHFFATVKLLHRTLLADEIGKQIVGASTVGLVVMALSGLYLRWPRRVTNWRSWLVIRW
SRAGRIRWWDVHTVLGTLVLPLYLLAAFSGLYWAYDWYRDGLQRLAGMPVVTKAKPVEGA
RQPLDGAALERTWNVFLANASNYGTATLRIDDARTGKVDINWLPADAPHDRAFNRLTLDA
STGVVIRNESFADKPPMQRLLAGMLPLHNGRYFGPIGVVLVLIGALMLPVFAATGWWLYL
DRRRRAQPQRKHASAATRPC